Qiagen
Home  >  Products  >  Anti-SLC33A1 (full length) polyclonal antibody

Anti-SLC33A1 (full length) polyclonal antibody

Cat no: DPABH-09768


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09768
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9197
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human SLC33A1 aa 1-549. (NP_004724.1).Sequence: MSPTISHKDSSRQRRPGNFSHSLDMKSGPLPPGGWDDSHLDSAGREGDRE ALLGDTGTGDFLKAPQSFRAELSSILLLLFLYVLQGIPLGLAGSIPLILQ SKNVSYTDQAFFSFVFWPFSLKLLWAPLVDAVYVKNFGRRKSWLVPTQYI LGLFMIYLSTQVDRLLG
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9197
Alternative names: SLC33A1; solute carrier family 33 (acetyl-CoA transporter), member 1; ACATN, acetyl Coenzyme A transporter; spastic paraplegia 42 (autosomal dominant); SPG42; acetyl-coenzyme A transporter 1; AT 1; AT1; AT-1; ACATN; SPG42; CCHLND;
Additional info: Probable acetyl-CoA transporter necessary for O-acetylation of gangliosides.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave