Qiagen
Home  >  Products  >  Anti-SLC20A1 (full length) polyclonal antibody

Anti-SLC20A1 (full length) polyclonal antibody

Cat no: DPABH-09609


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09609
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 6574
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human SLC20A1 aa 1-679.Sequence: MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGT AVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQG LLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGV KWSELIKIVMSWFVSPLLSGIMSGILFFLVRA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6574
Alternative names: SLC20A1; solute carrier family 20 (phosphate transporter), member 1; GLVR1; sodium-dependent phosphate transporter 1; gibbon ape leukemia virus receptor 1; Glvr 1; PiT 1; leukemia virus receptor 1 homolog; solute carrier family 20 member 1; PIT1; PiT-1; Glvr-1; FLJ41426; DKFZp686J2397;
Additional info: Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. May function as a retroviral receptor as it confers human cells susceptibility to infection to Gibbon Ape Leukemia Virus (GaLV), Simian sarcoma-associated virus (SSAV) and Feline leukemia virus subgroup B (FeLV-B) as well as 10A1 murine leukemia virus (10A1 MLV).

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave