Qiagen
Home  >  Products  >  Anti-SH3BGRL (full length) polyclonal antibody

Anti-SH3BGRL (full length) polyclonal antibody

Cat no: DPABH-09705


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09705
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 6451
Form: Liquid
Antigen: Full length protein corresponding to Human SH3BGRL aa 1-114. (AAH16709).Sequence: MVIRVYIASSSGSTAIKKKQQDVLGFLEANKIGFEEKDIAANEENRKWMR ENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAVYAFLGLTAP PGSKEAEVQAKQQA Database link: O75368 Run BLAST with Run BLAST with
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6451
Alternative names: SH3BGRL; SH3 domain binding glutamic acid-rich protein like; SH3 domain-binding glutamic acid-rich-like protein; MGC117402; SH3-binding domain glutamic acid-rich protein like; SH3BGR;
Additional info: SH3BGRL (SH3 domain binding glutamic acid-rich protein like) is a protein-coding gene. Diseases associated with SH3BGRL include endocarditis, and down syndrome. GO annotations related to this gene include SH3/SH2 adaptor activity and SH3 domain binding. An important paralog of this gene is SH3BGRL2.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave