Qiagen
Home  >  Products  >  Anti-S100A12 (full length) polyclonal antibody

Anti-S100A12 (full length) polyclonal antibody

Cat no: DPABH-09708


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09708
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 6283
Form: Liquid
Storage buffer: No additive
Antigen: Full length protein corresponding to Human S100A12 aa 1-92.Sequence: MTKLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKD KAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE Database link: NP_005612.1 Run BLAST with Run BLAST with
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6283
Alternative names: S100A12; S100 calcium binding protein A12; S100 calcium binding protein A12 (calgranulin C); S100 calcium binding protein A12 (calgranulin C); protein S100-A12; CAAF1; CAGC; CGRP; ENRAGE; MRP6; p6; EN-RAGE; calgranulin C; calgranulin-C; neutrophil S100 protein; calcium-binding protein in amniotic fluid 1; S100 calcium-binding protein A12 (calgranulin C); extracellular newly identified RAGE-binding protein;
Additional info: Calcitermin possesses antifungal activity against C.albicans and is also active against E.coli and P.aeruginosa but not L.monocytogenes and S.aureus. Binds calcium, zinc and copper. Presence of zinc increases the affinity for calcium. Plays an important role in the inflammatory response. Interaction with AGER on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave