Qiagen
Home  >  Products  >  Anti-RIOK3 (full length) polyclonal antibody

Anti-RIOK3 (full length) polyclonal antibody

Cat no: DPABH-09755


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09755
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 8780
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human RIOK3 aa 1-519.Sequence: MDLVGVASPEPGTAAAWGPSKCPWAIPQNTISCSLADVMSEQLAKELQLE EEAAVFPEVAVAEGPFITGENIDTSSDLMLAQMLQMEYDREYDAQLRREE KKFNGDSKVSISFENYRKVHPYEDSDSSEDEVDWQDTRDDPYRPAKPVPT PKKGFIGKGKDITTKHDEVVCGRKNTARMENFAP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8780
Alternative names: RIOK3; RIO kinase 3 (yeast); SUDD, sudD (suppressor of bimD6, Aspergillus nidulans) homolog; serine/threonine-protein kinase RIO3; sudD homolog; sudD suppressor of bimD6 homolog; homolog of the Aspergillus nidulans sudD gene product; sudD suppressor of Aspergillus nidulans bimD6 homolog; sudD (suppressor of bimD6, Aspergillus nidulans) homolog; SUDD; DKFZp779L1370;
Additional info: RIOK3 (RIO kinase 3) is a protein-coding gene. Diseases associated with RIOK3 include alcoholism, and melanoma. GO annotations related to this gene include protein serine/threonine kinase activity and ATP binding. An important paralog of this gene is RIOK1.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave