Qiagen
Home  >  Products  >  Anti-RGS20 (full length) polyclonal antibody

Anti-RGS20 (full length) polyclonal antibody

Cat no: DPABH-09665


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09665
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 8601
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human RGS20 aa 1-241. Isoform 5 (NP_003693.2).Sequence: MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQ PGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEE SPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMAC
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 8601
Alternative names: RGS20; regulator of G-protein signaling 20; regulator of G protein signalling 20; RGSZ1; ZGAP1; gz-GAP; g(z)GAP; regulator of G-protein signaling Z1; regulator of G-protein signalling 20; gz-selective GTPase-activating protein; regulator of G-protein signaling 20 variant 2; regulator of Gz-selective protein signaling 1;
Additional info: Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave