Qiagen
Home  >  Products  >  Anti-RBMS2 (full length) polyclonal antibody

Anti-RBMS2 (full length) polyclonal antibody

Cat no: DPABH-09741


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09741
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 5939
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human RBMS2 aa 1-407. (NP_002889.1).Sequence: MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN DQLSKTNLYIRGLQPGTTDQDLVKLCQPYGKIVSTKAILDKTTNKCKGYG FVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYISNLPLSMDEQE LEGMLKPFGQVISTRILRD
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5939
Alternative names: RBMS2; RNA binding motif, single stranded interacting protein 2; RNA-binding motif, single-stranded-interacting protein 2; SCR3; suppressor of CDC2 with RNA-binding motif 3; FLJ39093; FLJ40023; FLJ43262;
Additional info: RBMS2 (RNA binding motif, single stranded interacting protein 2) is a protein-coding gene. Diseases associated with RBMS2 include pyelonephritis, and measles. GO annotations related to this gene include RNA binding and nucleotide binding. An important paralog of this gene is PABPC1L.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave