Qiagen
Home  >  Products  >  Anti-RASA3 (full length) polyclonal antibody

Anti-RASA3 (full length) polyclonal antibody

Cat no: DPABH-09819


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09819
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 22821
Form: Liquid
Antigen: Full length protein corresponding to Human RASA3 aa 1-834.Sequence: MAVEDEGLRVFQSVKIKIGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRT KIVEKSLCPFYGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAIQKE DLQKYHNRDTWFQLQHVDADSEVQGKVHLELRLSEVITDTGVVCHKLATR IVECQGLPIVNGQCDPYATVTLAGPFRSEAKKTK
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 22821
Alternative names: RASA3; RAS p21 protein activator 3; ras GTPase-activating protein 3; GAP1IP4BP; GAPIII; GAP1(IP4BP); ins P4-binding protein; GTPase activating protein III; Ins(1,3,4,5)P4-binding protein; inositol 1,3,4,5-tetrakisphosphate-binding protein; MGC46517; MGC47588;
Additional info: Inhibitory regulator of the Ras-cyclic AMP pathway. Binds inositol tetrakisphosphate (IP4) with high affinity. Might be a specific IP4 receptor.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave