Qiagen
Home  >  Products  >  Anti-RAD51C (full length) polyclonal antibody

Anti-RAD51C (full length) polyclonal antibody

Cat no: DPABH-09710


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09710
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 5889
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human Rad51C aa 1-376.Sequence: MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEV GISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFI ITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAVDVQIPECFGG VAGEAVFIDTEGSFMVDRVVDLATACIQHLQLI
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5889
Alternative names: RAD51C; RAD51 homolog C (S. cerevisiae); RAD51 (S. cerevisiae) homolog C; DNA repair protein RAD51 homolog 3; RAD51L2; R51H3; RAD51-like protein 2; yeast RAD51 homolog 3; RAD51 homolog C, isoform 1; FANCO; BROVCA3; MGC104277;
Additional info: Essential for the homologous recombination (HR) pathway of DNA repair. Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The RAD51B-RAD51C dimer exhibits single-stranded DNA-dependent ATPase activity. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA. Participates in branch migration and Holliday junction resolution and thus is important for processing HR intermediates late in the DNA repair process. Also has an early function in DNA repair in facilitating phosphorylation of the checkpoint kinase CHK2 and thereby transduction of the damage signal, leading to cell cycle arrest and HR activation. Protects RAD51 from ubiquitin-mediated degradation that is enhanced following DNA damage. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51 and XRCC3. Contributes to DNA cross-link resistance, sister chromatid cohesion and genomic stability. Involved in maintaining centrosome number in mitosis.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave