Qiagen
Home  >  Products  >  Anti-RAB33A (full length) polyclonal antibody

Anti-RAB33A (full length) polyclonal antibody

Cat no: DPABH-09779


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09779
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 9363
Form: Liquid
Antigen: Full length protein corresponding to Human RAB33A aa 1-237.Sequence: MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKT CLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRK SMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAVPPLVPKVLVG NKCDLREQIQVPSNLALKFADAHNMLLFETSAK
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9363
Alternative names: RAB33A; RAB33A, member RAS oncogene family; ras-related protein Rab-33A; RabS10; Small GTP-binding protein S10; MGC1488;
Additional info: RAB33A (RAB33A, member RAS oncogene family) is a protein-coding gene. Diseases associated with RAB33A include alport syndrome, and tuberculosis, and among its related super-pathways are Sertoli-Sertoli Cell Junction Dynamics. GO annotations related to this gene include GTP binding and GTPase activity. An important paralog of this gene is RAB33B.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave