Qiagen
Home  >  Products  >  Anti-PROP1 (full length) polyclonal antibody

Anti-PROP1 (full length) polyclonal antibody

Cat no: DPABH-09565


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09565
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 5626
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human PROP1 aa 1-226.Sequence: MEAERRRQAEKPKKGRVGSSLLPERHPATGTPTTTVDSSAPPCRRLPGAG GGRSRFSPQGGQRGRPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARE SLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSPAAFSSFLPES TACPYSYAAPPPPVTCFPHPYS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5626
Alternative names: PROP1; PROP paired-like homeobox 1; prophet of Pit1, paired like homeodomain transcription factor; homeobox protein prophet of Pit-1; pituitary-specific homeodomain factor; prophet of Pit1, paired-like homeodomain transcription factor; CPHD2; PROP-1;
Additional info: PROP1 belongs to the paired homeobox family. It contains one homeobox DNA-binding domain. PROP1 is possibly involved in the ontogenesis of pituitary gonadotropes, as well as somatotropes, lactotropes and caudomedial thyrotropes. It is expressed specifically in embryonic pituitary. Defects in PROP1 are a cause of combined pituitary hormone deficiency (CPHD). This is characterized by impaired production of growth hormone (GH) and one or more of the other five anterior pituitary hormones.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave