Qiagen
Home  >  Products  >  Anti-PPP2CB (full length) polyclonal antibody

Anti-PPP2CB (full length) polyclonal antibody

Cat no: DPABH-09593


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09593
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 5516
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human PPP2CB aa 1-309.Sequence: MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRC PVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLL VALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLF DYLPLTALVDGQIFCLHGGLSPSIDTLDHIRAL
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5516
Alternative names: PPP2CB; protein phosphatase 2, catalytic subunit, beta isozyme; protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform; serine/threonine-protein phosphatase 2A catalytic subunit beta isoform; PP2Abeta; protein phosphatase 2A catalytic subunit; beta isoform; PP2A-beta; protein phosphatase type 2A catalytic subunit; protein phosphatase 2, catalytic subunit, beta isoform; protein phosphatase 2A catalytic subunit, beta isoform; serine/threonine protein phosphatase 2A, catalytic subunit, beta isoform; PP2CB;
Additional info: PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave