Qiagen
Home  >  Products  >  Anti-PPEF1 (full length) polyclonal antibody

Anti-PPEF1 (full length) polyclonal antibody

Cat no: DPABH-09599


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09599
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 5475
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human PPEF1 aa 1-653. (NP_006231.2).Sequence: MGCSSSSTKTRRSDTSLRAALIIQNWYRGYKARLKARQHYALTIFQSIEY ADEQGQMQLSTFFSFMLENYTHIHKEELELRNQSLESEQDMRDRWDYVDS IDVPDSYNGPRLQFPLTCTDIDLLLEAFKEQQILHAHYVLEVLFETKKVL KQMPNFTHIQTSPSKEVTI
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5475
Alternative names: PPEF1; protein phosphatase, EF-hand calcium binding domain 1; PPEF; serine/threonine-protein phosphatase with EF-hands 1; PPP7CA; protein phosphatase 7; catalytic subunit; alpha isozyme; serine/threonine protein phosphatase 7; serine/threonine-protein phosphatase 7; protein phosphatase with EF calcium-binding domain; protein phosphatase 7, catalytic subunit, alpha isozyme; protein phosphatase, serine/threonine type, with EF-hands; PP7; PPP7C;
Additional info: May have a role in the recovery or adaptation response of photoreceptors. May have a role in development.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave