Qiagen
Home  >  Products  >  Anti-POLE (full length) polyclonal antibody

Anti-POLE (full length) polyclonal antibody

Cat no: DPABH-09563


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09563
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 5426
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human POLE aa 1-370. This sequence corresponds to aa 1917-2286 fragment from Swissprot Q07864.Sequence: MDPSNYGGIKGKVSSRIHCGLQDSQKAGGAEDEQENEDDEEERDGEEEEE AEESNVEDLLENNWNILQFLPQAASCQNYFLMIVSAYIVAVYHCMKDGLR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5426
Alternative names: POLE; polymerase (DNA directed), epsilon; DNA polymerase epsilon catalytic subunit A; POLE1; DNA polymerase II subunit A; FLJ21434; DKFZp434F222;
Additional info: Participates in DNA repair and in chromosomal DNA replication.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave