Qiagen
Home  >  Products  >  Anti-POGZ (aa 1-562) polyclonal antibody

Anti-POGZ (aa 1-562) polyclonal antibody

Cat no: DPABH-09460


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09460
Reactivities: Human, Mouse
Hosts: Rabbit
Applications: Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
Size: 100 ul
Clone: N/A
Gene: 23126
Form: Liquid
Antigen: Recombinant fragment corresponding to Human POGZ aa 1-562 (N terminal).Sequence: MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVS APVPIAAHASVAGHLSTSTTVSSSGAQNSDSTKKTLVTLIANNNAGNPLV QQGGQPLILTQNPAPGLGTMVTQPVLRPVQVMQNANHVTSSPVASQPIFI TTQGFPVRNVRPVQNAMNQVG
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 23126
Alternative names: POGZ; pogo transposable element with ZNF domain; KIAA0461; putative protein product of Nbla00003; SUHW5; suppressor of hairy wing homolog 5; zinc finger protein 280E; ZNF280E; ZNF635m; zinc finger protein 635; ZNF635; MGC71543;
Additional info: Plays a role in mitotic cell cycle progression and is involved in kinetochore assembly and mitotic sister chromatid cohesion. Probably through its association with CBX5 plays a role in mitotic chromosome segregation by regulating aurora kinase B/AURKB activation and AURKB and CBX5 dissociation from chromosome arms.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave