Qiagen
Home  >  Products  >  Anti-PITX1 (full length) polyclonal antibody

Anti-PITX1 (full length) polyclonal antibody

Cat no: DPABH-09602


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09602
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 5307
Form: Liquid
Antigen: Full length protein corresponding to Human PITX1 aa 1-314.Sequence: MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASES SDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQ LQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERN QQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNW
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5307
Alternative names: PITX1; paired-like homeodomain 1; BFT, paired like homeodomain transcription factor 1; pituitary homeobox 1; POTX; PTX1; pituitary homeo box 1; homeobox protein PITX1; pituitary otx-related factor; hindlimb expressed homeobox protein backfoot; hindlimb-expressed homeobox protein backfoot; paired-like homeodomain transcription factor 1; BFT; CCF;
Additional info: May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave