Qiagen
Home  >  Products  >  Anti-PIN4 (full length) polyclonal antibody

Anti-PIN4 (full length) polyclonal antibody

Cat no: DPABH-09584


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09584
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 5303
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human PIN4 aa 1-156. Isoform 2 (NP_006214.2).Sequence: MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD KKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDK ARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHII MVEGRK Dat
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5303
Alternative names: PIN4; protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin); protein (peptidyl prolyl cis/trans isomerase) NIMA interacting, 4 (parvulin); peptidyl-prolyl cis-trans isomerase NIMA-interacting 4; EPVH; PAR14; PAR17; hEPVH; hPar14; hPar17; PPIase PIN4; parvulin-14; parvulin-17; rotamase PIN4; eukaryotic parvulin homolog; peptidyl-prolyl cis-trans isomerase Pin4; peptidyl-prolyl cis/trans isomerase EPVH; MGC138486;
Additional info: Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.Isoform 2 binds to double-stranded DNA.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave