Qiagen
Home  >  Products  >  Anti-PHKA2 (full length) polyclonal antibody

Anti-PHKA2 (full length) polyclonal antibody

Cat no: DPABH-09588


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09588
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 5256
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human PHKA2.Sequence: MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHEQKDAWVRDNIYS ILAVWGLGMAYRKNADRDEDKAKAYELEQNVVKLMRGLLQCMMRQVAKVE KFKHTQSTKDSLHAKYNTATCGTVVGDDQWGHLQVDATSLFLLFLAQMTA SGLRIIFTLDEVAFIQNLVFYIEAAYKVADYGMWERGDKTNQG
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C or -80 degrees C. Avoid freeze / thaw cycle.
Entrez gene: 5256
Alternative names: PHKA2; phosphorylase kinase, alpha 2 (liver); PHK, PYK; phosphorylase b kinase regulatory subunit alpha, liver isoform; phosphorylase kinase alpha-subunit; phosphorylase kinase alpha L subunit; phosphorylase b kinase regulatory subunit alpha liver isoform; PHK; PYK; XLG; PYKL; XLG2; GSD9A; MGC133071;
Additional info: PHKA2 belongs to the phosphorylase b kinase regulatory chain family. It is a polymer of 16 chains, four each of alpha, beta, gamma, and delta. Alpha and beta are regulatory chains, gamma is the catalytic chain, and delta is calmodulin. It catalyzes the phosphorylation of serine in certain substrates, including troponin I. The alpha chain may bind calmodulin.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave