Qiagen
Home  >  Products  >  Anti-PFKL (full length) polyclonal antibody

Anti-PFKL (full length) polyclonal antibody

Cat no: DPABH-09572


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09572
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 5211
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human PFKL aa 1-827. Isoform 2. Swissprot: P17858-2Sequence: MCNQGRGRESSRGGLHVQGSCRGLSRSPQQETGFAKAPAGTDCFFHCSPG SRGQGDRKEEVTSEPGGTSIMSRLGGMNAAVRAVTRMGIYVGAKVFLIYE GYEGLVEGGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAY NLVQ
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 5211
Alternative names: PFKL; phosphofructokinase, liver; 6-phosphofructokinase, liver type; phosphohexokinase; phosphofructokinase 1; liver-type 1-phosphofructokinase; phosphofructo-1-kinase isozyme B; PFK-B; FLJ30173; FLJ40909; DKFZp686G1648; DKFZp686L2097;
Additional info: PFKL is the Liver isozyme of PFK (Phosphofructokinase), which is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. Separate genes encode a muscle subunit (M) and a liver subunit (L). PFK from muscle is a homotetramer of M subunits, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave