Qiagen
Home  >  Products  >  Anti-OSMR (full length) polyclonal antibody

Anti-OSMR (full length) polyclonal antibody

Cat no: DPABH-09694


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09694
Reactivities: Human
Hosts: Rabbit
Applications: Immunocytochemistry, Immunofluorescence, Western Blot
Size: 100 ug
Clone: N/A
Gene: 9180
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human OSMR aa 1-342. Isoform 2 Q99650-2Sequence: MALFAVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSTRQSLHL QWTVHNLPYHQELKMVFQIQISRIETSNVIWVGNYSTTVKWNQVLHWSWE SELPLECATHFVRIKSLVDDAKFPEPNFWSNWSSWEEVSVQDSTGQDILF VFPKDKLVEEGTNVTI
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9180
Alternative names: OSMR; oncostatin M receptor; oncostatin-M-specific receptor subunit beta; OSMRB; IL-31RB; IL-31R-beta; IL-31R subunit beta; IL-31 receptor subunit beta; interleukin-31 receptor subunit beta; oncostatin-M specific receptor beta subunit; PLCA1; MGC75127; MGC150626; MGC150627;
Additional info: Associates with IL31RA to form the IL31 receptor. Binds IL31 to activate STAT3 and possibly STAT1 and STAT5. Capable of transducing OSM-specific signaling events.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave