Qiagen
Home  >  Products  >  Anti-NFS1 (full length) polyclonal antibody

Anti-NFS1 (full length) polyclonal antibody

Cat no: DPABH-09692


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09692
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9054
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human NFS1 aa 1-457.Sequence: MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAP EVGPVLRPLYMDVQATTPLDPRVLDAMLPYLINYYGNPHSRTHAYGWESE AAMERARQQVASLIGADPREIIFTSGATESNNIAIKGVARFYRSRKKHLI TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIID
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9054
Alternative names: NFS1; NFS1 nitrogen fixation 1 homolog (S. cerevisiae); nitrogen fixation 1 (S. cerevisiae, homolog); cysteine desulfurase, mitochondrial; IscS; NifS; nitrogen-fixing bacteria S-like protein; NIFS; HUSSY-08;
Additional info: NFS1 catalyzes the removal of elemental sulfur from cysteine to produce alanine and supplies the inorganic sulfur for iron-sulfur (Fe-S) clusters.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave