Qiagen
Home  >  Products  >  Anti-NDUFS8 (full length) polyclonal antibody

Anti-NDUFS8 (full length) polyclonal antibody

Cat no: DPABH-09529


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09529
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 4728
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human NDUFS8 aa 1-210. (NP_002487.1).Sequence: MRCLTTPMLLRALAQAARAGPPGGRSLHSSAVAATYKYVNMQDPEMDMKS VTDRAARTLLWTELFRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHA LRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKC IYCGFC
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4728
Alternative names: NDUFS8; NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase); NADH dehydrogenase (ubiquinone) Fe S protein 8 (23kD) (NADH coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial; CI 23k; complex I 23kDa subunit; NADH dehydrogenase [ubiquinone] iron sulfur protein 8; mitochondrial; TYKY; complex I-23kD; NADH-ubiquinone oxidoreductase 23 kDa subunit; CI-23k; CI23KD;
Additional info: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity). May donate electrons to ubiquinone.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave