Qiagen
Home  >  Products  >  Anti-NDUFB7 (full length) polyclonal antibody

Anti-NDUFB7 (full length) polyclonal antibody

Cat no: DPABH-09540


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09540
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 4713
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human NDUFB7 aa 1-137. (NP_004137.2).Sequence: MGAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQ LRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMK EFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL Database link: P17568 Run BLAST
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4713
Alternative names: NDUFB7; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7 (18kD, B18); NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7; B18; CI B18; complex I B18 subunit; MGC2480; NADH ubiquinone oxidoreductase B18 subunit; complex I-B18; cell adhesion protein SQM1; NADH-ubiquinone oxidoreductase B18 subunit; CI-B18;
Additional info: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave