Qiagen
Home  >  Products  >  Anti-NDUFA5 (full length) polyclonal antibody

Anti-NDUFA5 (full length) polyclonal antibody

Cat no: DPABH-09528


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09528
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 4698
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human NDUFA5 aa 1-116. (NP_004991.1).Sequence: MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQ ITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLW EPLVEEPPADQWKWPI Database link: Q16718 Run BLAST with Run BLAST with
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4698
Alternative names: NDUFA5; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 (13kD, B13); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; B13; CI 13kB; CI 13KD B; complex I 13kDa subunit B; NADH ubiquinone oxidoreductase 13 kDa B subunit; NUFM; type I dehydrogenase; ubiquinone reductase; UQOR13; Complex I-13KD-B; complex I subunit B13; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; CI-13kB; CI-13KD-B; FLJ12147; DKFZp781K1356;
Additional info: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave