Qiagen
Home  >  Products  >  Anti-MYL5 (full length) polyclonal antibody

Anti-MYL5 (full length) polyclonal antibody

Cat no: DPABH-09534


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09534
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 4636
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human MYL5 aa 1-173. (NP_002468.1).Sequence: MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFI DKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTD AEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASI DVAGNLDYKALSYVITHGEE
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4636
Alternative names: MYL5; myosin, light chain 5, regulatory; myosin, light polypeptide 5, regulatory; myosin light chain 5; MYLC2; myLC-2; myosin regulatory light chain 5; superfast myosin regulatory light chain 2;
Additional info: MYL5 (myosin, light chain 5, regulatory) is a protein-coding gene. Among its related super-pathways are Immune response CCR3 signaling in eosinophils and Activation of cAMP-Dependent PKA. GO annotations related to this gene include structural constituent of muscle and calcium ion binding. An important paralog of this gene is MYL12A.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave