Qiagen
Home  >  Products  >  Anti-MYL4 (full length) polyclonal antibody

Anti-MYL4 (full length) polyclonal antibody

Cat no: DPABH-09555


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09555
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 4635
Form: Liquid
Antigen: Full length protein corresponding to Human MYL4 aa 1-197. (NP_001002841).Sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA DQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGK PKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTV MGAELRHVLATLGEKMTEA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4635
Alternative names: MYL4; myosin, light chain 4, alkali; atrial, embryonic; myosin, light polypeptide 4, alkali; atrial, embryonic; myosin light chain 4; ALC1; AMLC; GT1; myosin; atrial/fetal muscle; light chain; PRO1957; myosin light chain alkali GT-1 isoform; myosin, atrial/fetal muscle, light chain; myosin light chain 1, embryonic muscle/atrial isoform; myosin, light polypeptide 4, alkali; atrial, embryonic;
Additional info: Regulatory light chain of myosin. Does not bind calcium.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave