Qiagen
Home  >  Products  >  Anti-MRPL12 (full length) polyclonal antibody

Anti-MRPL12 (full length) polyclonal antibody

Cat no: DPABH-09745


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09745
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 6182
Form: Liquid
Antigen: Full length protein corresponding to Human MRPL12 aa 1-198. (NP_002940.2)Sequence: MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAG APLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPM GGVMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIK NYIQGINLVQAKKLVESLP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 6182
Alternative names: MRPL12; mitochondrial ribosomal protein L12; RPML12; 39S ribosomal protein L12, mitochondrial; MRPL7; MRPL7/L12; MRP-L12; 5c5-2; L12mt; MRP-L31/34; MGC8610; FLJ60124;
Additional info: MRPL12 (mitochondrial ribosomal protein L12) is a protein-coding gene. Diseases associated with MRPL12 include pneumonia, and prostate cancer, and among its related super-pathways are Viral mRNA Translation. GO annotations related to this gene include structural constituent of ribosome and RNA binding.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave