Qiagen
Home  >  Products  >  Anti-MPP3 (full length) polyclonal antibody

Anti-MPP3 (full length) polyclonal antibody

Cat no: DPABH-09536


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09536
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 4356
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human MPP3 aa 1-585. (NP_001923.2).Sequence: MPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIH EKLRYYERQSPTPVLHSAVALAEDVMEELQAASVHSDERELLQLLSTPHL RAVLMVHDTVAQKNFDPVLPPLPDNIDEDFDEESVKIVRLVKNKEPLGAT IRRDEHSGAVVVARIMRGGA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4356
Alternative names: MPP3; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3); DLG3; MAGUK p55 subfamily member 3; discs; large (Drosophila) homolog 3; membrane protein palmitoylated 3; discs large homolog 3; discs, large homolog 3;
Additional info: MPP3 (membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3)) is a protein-coding gene, and is affiliated with the lncRNA class. Diseases associated with MPP3 include intellectual disability, and pneumonia. GO annotations related to this gene include PDZ domain binding and guanylate kinase activity. An important paralog of this gene is MPP6.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave