Qiagen
Home  >  Products  >  Anti-MPP1 (full length) polyclonal antibody

Anti-MPP1 (full length) polyclonal antibody

Cat no: DPABH-09530


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09530
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 4354
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human MPP1 aa 1-466. (NP_002427.1).Sequence: MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTN GSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVARIL HGGMIHRQGSLHVGDEILEINGTNVTNHSVDQLQKAMKETKGMISLKVIP NQQSRLPALQMFMRAQFDYD
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4354
Alternative names: MPP1; membrane protein, palmitoylated 1, 55kDa; DXS552E, membrane protein, palmitoylated 1 (55kD); 55 kDa erythrocyte membrane protein; PEMP; p55; aging-associated gene 12; migration-related gene 1; erythrocyte membrane protein p55; palmitoylated erythrocyte membrane protein; MRG1; AAG12; EMP55; DXS552E;
Additional info: Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave