Qiagen
Home  >  Products  >  Anti-MOS (full length) polyclonal antibody

Anti-MOS (full length) polyclonal antibody

Cat no: DPABH-09539


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09539
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 4342
Form: Liquid
Antigen: Full length protein corresponding to Human MOS aa 1-346. (NP_005363.1).Sequence: MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRL AWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASR RSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQV IYGAAGHPEGDAGEPHCRTGG
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4342
Alternative names: MOS; v-mos Moloney murine sarcoma viral oncogene homolog; proto-oncogene serine/threonine-protein kinase mos; c-mos; proto-oncogene c-Mos; oocyte maturation factor mos; oncogene MOS, Moloney murine sarcoma virus; MSV; MGC119962; MGC119963;
Additional info: MOS (v-mos Moloney murine sarcoma viral oncogene homolog) is a protein-coding gene. Diseases associated with MOS include sarcoma, and gastric cancer, and among its related super-pathways are Regulation of actin cytoskeleton and MAPK signaling pathway. GO annotations related to this gene include protein serine/threonine kinase activity and ATP binding. An important paralog of this gene is FPGT-TNNI3K.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave