Qiagen
Home  >  Products  >  Anti-MLLT6 (full length) polyclonal antibody

Anti-MLLT6 (full length) polyclonal antibody

Cat no: DPABH-09547


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09547
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 4302
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human MLLT6 aa 1-325.Sequence: MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQACYGIVQVPTGPWF CRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANV LTMEPIVLQYVPHDRFNKTCYICEEQGRESKAASGACMTCNRHGCRQAFH VTCAQMAGLLCEEEVLEVDNVK
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4302
Alternative names: MLLT6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6; myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 6; protein AF-17; AF17; FLJ23480; Myeloid/lymphoid or mixed lineage leukemia; translocated to; 6; trithorax homolog; ALL1-fused gene from chromosome 17 protein; Myeloid/lymphoid or mixed-lineage leukemia, translocated to, 6; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog); translocated to, 6;
Additional info: MLLT6 (myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 6) is a protein-coding gene. Diseases associated with MLLT6 include acute monocytic leukemia, and monocytic leukemia. GO annotations related to this gene include protein binding and zinc ion binding. An important paralog of this gene is PHF17.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave