Qiagen
Home  >  Products  >  Anti-MCM5 (full length) polyclonal antibody

Anti-MCM5 (full length) polyclonal antibody

Cat no: DPABH-09462


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09462
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 4174
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human MCM5 aa 1-734.Sequence: MSGFDDPGIFYSDSFGGDAQADEGQARKSQLQRRFKEFLRQYRVGTDRTG FTFKYRDELKRHYNLGEYWIEVEMEDLASFDEDLADYLYKQPAEHLQLLE EAAKEVADEVTRPRPSGEEVLQDIQVMLKSDASPSSIRSLKSDMMSHLVK IPGIIIAASAVRAKATRISIQCR
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4174
Alternative names: MCM5; minichromosome maintenance complex component 5; CDC46, MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S. cerevisiae); minichromosome maintenance deficient (S. cerevisiae) 5 (cell division cycle 46); DNA replication licensing factor MCM5; CDC46 homolog; minichromosome maintenance deficient 5 (cell division cycle 46); MCM5 minichromosome maintenance deficient 5, cell division cycle 46; CDC46; P1-CDC46; MGC5315;
Additional info: MCM5 (minichromosome maintenance complex component 5) is a protein-coding gene. Diseases associated with MCM5 include melanoacanthoma, and desmoid tumor, and among its related super-pathways are Activation of the pre-replicative complex and Lagging Strand Synthesis. GO annotations related to this gene include helicase activity and ATP binding.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave