Qiagen
Home  >  Products  >  Anti-MCC (full length) polyclonal antibody

Anti-MCC (full length) polyclonal antibody

Cat no: DPABH-09503


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09503
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 4163
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human MCC aa 1-829.Sequence: MNSGVAMKYGNDSSAELSELHSAALASLKGDIVELNKRLQQTERERDLLE KKLAKAQCEQSHLMREHEDVQERTTLRYEERITELHSVIAELNKKIDRLQ GTTIREEDEYSELRSELSQSQHEVNEDSRSMDQDQTSVSIPENQSTMVTA DMDNCSDLNSELQRVLTGLENVVCGRKKSSCSLSVA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4163
Alternative names: MCC; mutated in colorectal cancers; colorectal mutant cancer protein; MCC1; FLJ38893; FLJ46755; DKFZp762O1615;
Additional info: Candidate for the putative colorectal tumor suppressor gene located at 5q21. Suppresses cell proliferation and the Wnt/b-catenin pathway in colorectal cancer cells. Inhibits DNA binding of b-catenin/TCF/LEF transcription factors. Involved in cell migration independently of RAC1, CDC42 and p21-activated kinase (PAK) activation.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave