Qiagen
Home  >  Products  >  Anti-MAGED1 (full length) polyclonal antibody

Anti-MAGED1 (full length) polyclonal antibody

Cat no: DPABH-09795


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09795
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9500
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human MAGED1 aa 1-778. (NP_001005332.1)Sequence: MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAAS PQSSQPPTANEMADIQVSAAAARPKSAFKVQNATTKGPNGVYDFSQAHNA KDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAANKSEMAFKAQN ATTKVGPNATYNFSQS
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9500
Alternative names: MAGED1; melanoma antigen family D, 1; melanoma-associated antigen D1; DLXIN 1; NRAGE; MAGE-D1 antigen; MAGE tumor antigen CCF; neurotrophin receptor-interacting MAGE homolog; DLXIN-1;
Additional info: Involved in the apoptotic response after nerve growth factor (NGF) binding in neuronal cells. Binds NGFR/p75NTR and antagonizes its association with NTRK1/TrkA, inhibits cell cycle progression, and facilitates NGFR-mediated apoptosis. May act as a regulator of the function of DLX family members. May regulate TP53/p53 transcriptional activity and inhibit cell proliferation. Enhances TP53 phosphorylation and accumulation. May enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave