Qiagen
Home  >  Products  >  Anti-MAGEA8 (full length) polyclonal antibody

Anti-MAGEA8 (full length) polyclonal antibody

Cat no: DPABH-09477


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09477
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ul
Clone: N/A
Gene: 4107
Form: Liquid
Antigen: Full length protein corresponding to Human MAGEA8 aa 1-318. (NP_005355.2).Sequence: MLLGQKSQRYKAEEGLQAQGEAPGLMDVQIPTAEEQKAASSSSTLIMGTL EEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPD PAHLESLFREALDEKVAELVRFLLRKYQIKEPVTKAEMLESVIKNYKNHF PDIFSKASECMQVIFGID
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4107
Alternative names: MAGEA8; melanoma antigen family A, 8; MAGE8; melanoma-associated antigen 8; cancer/testis antigen family 1; member 8; CT1.8; MAGE 8 antigen; MGC2182; MAGE-8 antigen; cancer/testis antigen 1.8; cancer/testis antigen family 1, member 8;
Additional info: Not known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave