Qiagen
Home  >  Products  >  Anti-LY6E (full length) polyclonal antibody

Anti-LY6E (full length) polyclonal antibody

Cat no: DPABH-09502


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09502
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 4061
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human Ly-6A/E aa 1-131. (NP_002337.1)Sequence: MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVT VSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNF SAADGGLRASVTLLGAGLLLSLLPALLRFGP Database link: Q16553
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 4061
Alternative names: LY6E; lymphocyte antigen 6 complex, locus E; lymphocyte antigen 6E; retinoic acid induced gene E; RIG E; SCA 2; TSA 1; ly-6E; stem cell antigen 2; thymic shared antigen 1; retinoic acid-induced gene E protein; RIGE; SCA2; RIG-E; SCA-2; TSA-1;
Additional info: LY6E (lymphocyte antigen 6 complex, locus E) is a protein-coding gene. Diseases associated with LY6E include subvalvular aortic stenosis, and acute promyelocytic leukemia.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave