Qiagen
Home  >  Products  >  Anti-LRRFIP2 (full length) polyclonal antibody

Anti-LRRFIP2 (full length) polyclonal antibody

Cat no: DPABH-09794


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09794
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9209
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human LRRFIP2 aa 1-400. Isoform 2 (NP_060194.1).Sequence: MGTPASGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRM RELERQQKELDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTS SLIDPDTSLSELRESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDV IEEQEEQ
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9209
Alternative names: LRRFIP2; leucine rich repeat (in FLII) interacting protein 2; leucine-rich repeat flightless-interacting protein 2; HUFI 2; LRR FLII-interacting protein 2; HUFI-2; FLJ20248; FLJ22683; FLJ58304; DKFZp434H2035;
Additional info: May function as activator of the canonical Wnt signaling pathway, in association with DVL3, upstream of CTNNB1/beta-catenin.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave