Qiagen
Home  >  Products  >  Anti-KRT6B (full length) polyclonal antibody

Anti-KRT6B (full length) polyclonal antibody

Cat no: DPABH-09517


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09517
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3854
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human KRT6B aa 1-564.Sequence: MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGA CGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF GFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNL QIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFL
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3854
Alternative names: KRT6B; keratin 6B; keratin like 1 (a type II keratin sequence); KRTL1; keratin, type II cytoskeletal 6B; keratin-6B; cytokeratin 6B; cytokeratin-6B; type-II keratin Kb10; keratin, epidermal, type II, K6B; keratin-like 1 (a type II keratin sequence); K6B; PC2; CK6B; CK-6B; KRTL1;
Additional info: KRT6B (keratin 6B) is a protein-coding gene. Diseases associated with KRT6B include pachyonychia congenita, and pachyonychia congenita type 2. GO annotations related to this gene include structural constituent of cytoskeleton. An important paralog of this gene is KRT74.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave