Qiagen
Home  >  Products  >  Anti-KIR3DL1 (full length) polyclonal antibody

Anti-KIR3DL1 (full length) polyclonal antibody

Cat no: DPABH-09473


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09473
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 3811
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human KIR3DL1 aa 1-382. Genebank Accession: NP_001077008Sequence: MLLMVVSMACVGLFLVQRAGPHMGGQDKPFLSAWPSAVVPRGGHVTLRCH YRHRFNNFMLYKEDRIHVPIFHGRIFQEGFNMSPVTTAHAGNYTCRGSHP HSPTGWSAPSNPMVIMVTGNHRKPSLLAHPGPLVKSGE
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3811
Alternative names: KIR3DL1; killer cell immunoglobulin-like receptor, three domains, long cytoplasmic tail, 1; KIR; killer cell immunoglobulin-like receptor 3DL1; AMB11; CD158e1; CD158e1/2; CD158e2; cl 2; cl 11; nkat3; NKB1; NKB1B; NKAT-3; NK-receptor; KIR antigen 3DL1; killer Ig receptor; p70 NK receptor CL-2/CL-11; MHC class I NK cell receptor; CD158 antigen-like family member E; p70 killer cell inhibitory receptor; natural killer-associated transcript 3; HLA-BW4-specific inhibitory NK cell receptor; p70 natural killer cell receptor clones CL-2/CL-11; NKAT3; CD158E1; KIR3DL1/S1; MGC119726; MGC119728; MGC126589; MGC126591;
Additional info: Receptor on natural killer (NK) cells for HLA Bw4 allele. Inhibits the activity of NK cells thus preventing cell lysis.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave