Qiagen
Home  >  Products  >  Anti-KIAA0101 (full length) polyclonal antibody

Anti-KIAA0101 (full length) polyclonal antibody

Cat no: DPABH-09756


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09756
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 9768
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human KIAA0101 aa 1-111.Sequence: MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGG NPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACP LQPDHTNDEKE Database link: NP_055551.1
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9768
Alternative names: KIAA0101; PCNA-associated factor; NS5ATP9; OEATC 1; p15(PAF); HCV NS5A-transactivated protein 9; hepatitis C virus NS5A-transactivated protein 9; overexpressed in anaplastic thyroid carcinoma 1; L5; PAF; OEATC; OEATC1; p15PAF; OEATC-1; p15/PAF; FLJ58702;
Additional info: May be involved in protection of cells from UV-induced cell death.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave