Qiagen
Home  >  Products  >  Anti-IL10RB (full length) polyclonal antibody

Anti-IL10RB (full length) polyclonal antibody

Cat no: DPABH-09505


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09505
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3588
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human IL10RB aa 1-325. (NP_000619.3)Sequence: MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNL TFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDW VNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYN SWTYNVQYWKNGTDEKFQI
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3588
Alternative names: IL10RB; interleukin 10 receptor, beta; CRFB4, D21S58, D21S66; interleukin-10 receptor subunit beta; CDW210B; CRF2 4; IL 10R2; IL-10RB; IL-10R subunit 2; IL-10R subunit beta; IL-10 receptor subunit beta; cytokine receptor class-II CRF2-4; interleukin-10 receptor subunit 2; cytokine receptor class-II member 4; cytokine receptor family 2 member 4; cytokine receptor family II, member 4; CRFB4; CRF2-4; D21S58; D21S66; IL-10R2;
Additional info: Shared cell surface receptor required for the activation of five class 2 cytokines: IL10, IL22, IL26, IL28, and IL29.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave