Qiagen
Home  >  Products  >  Anti-IFRD2 (full length) polyclonal antibody

Anti-IFRD2 (full length) polyclonal antibody

Cat no: DPABH-09654


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09654
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 7866
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human IFRD2 aa 1-442.Sequence: MPRARKGNTLRKGGQRRGGGARSSAQADSGSSDDEAASEARSTASECPSL LSTTAEDSLGGDVVDEQGQQEDLEEKLKEYVDCLTDKSAKTRQGALESLR LALASRLLPDFLLERRLTLADALEKCLKKGKGEEQALAAAVLGLLCVQLG PGPKGEELFHSLQPLLVSVLSD
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 7866
Alternative names: IFRD2; interferon-related developmental regulator 2; IFNRP; interferon related protein; SKMc15; SM15; interferon-related protein; FLJ40446;
Additional info: IFRD2 (interferon-related developmental regulator 2) is a protein-coding gene. Diseases associated with IFRD2 include alopecia areata, and alopecia. GO annotations related to this gene include protein binding and molecular_function. An important paralog of this gene is IFRD1.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave