Qiagen
Home  >  Products  >  Anti-IFNAR1 (full length) polyclonal antibody

Anti-IFNAR1 (full length) polyclonal antibody

Cat no: DPABH-09475


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09475
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3454
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human IFNAR1 aa 1-557. (NP_000620).Sequence: MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWN RSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEI KLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDKAIVIHISPGT KDSVMWALDGLSFTYSLVIW
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3454
Alternative names: IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC; CRF2-1; IFN-R-1; IFN-alpha/beta receptor 1; interferon-beta receptor 1; beta-type antiviral protein; alpha-type antiviral protein; type I interferon receptor 1; cytokine receptor class-II member 1; cytokine receptor family 2 member 1; interferon-alpha/beta receptor alpha chain; AVP; IFNBR; IFN-alpha-REC;
Additional info: Associates with IFNAR2 to form the type I interferon receptor. Receptor for interferons alpha and beta. Binding to type I IFNs triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and IFNR alpha- and beta-subunits themselves.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave