Qiagen
Home  >  Products  >  Anti-IDI1 (full length) polyclonal antibody

Anti-IDI1 (full length) polyclonal antibody

Cat no: DPABH-09459


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09459
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3422
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human IDI1 aa 1-228.Sequence: MMPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGL LHRAFSVFLFNTENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEES DALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQSDGIWGEHEI DYILLVRKNVTLNPDPNEIKSYC
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3422
Alternative names: IDI1; isopentenyl-diphosphate delta isomerase 1; isopentenyl diphosphate delta isomerase; isopentenyl-diphosphate Delta-isomerase 1; IPP isomerase; IPP isomerase 1; isopentenyl pyrophosphate isomerase 1; isopentenyl diphosphate dimethylallyl diphosphate isomerase 1; IPP1; IPPI1;
Additional info: Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP).

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave