Qiagen
Home  >  Products  >  Anti-HOXA7 (full length) polyclonal antibody

Anti-HOXA7 (full length) polyclonal antibody

Cat no: DPABH-09454


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09454
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 3204
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human HOXA7 aa 1-230.Sequence: MSSSYYVNALFSKYTAGASLFQNAEPTSCSFAPNSQRSGYGAGAGAFAST VPGLYNVNSPLYQSPFASGYGLGADAYGNLPCASYDQNIPGLCSDLAKGA CDKTDEGALHGAAEANFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFH FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Allow to warm to room temp and agitate gently before aliquotting. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3204
Alternative names: HOXA7; homeobox A7; homeo box A7; HOX1, HOX1A; homeobox protein Hox-A7; homeo box A7; homeobox protein HOX-1A; homeobox protein Hox 1.1; ANTP; HOX1; HOX1A; HOX1.1;
Additional info: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave