Qiagen
Home  >  Products  >  Anti-HOXA5 (full length) polyclonal antibody

Anti-HOXA5 (full length) polyclonal antibody

Cat no: DPABH-09442


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09442
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3202
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human HOXA5 aa 1-270. (AAH13682).Sequence: MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYN GMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDP LPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAE EDAPASSEQASAQSEPSPAPPA
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3202
Alternative names: HOXA5; homeobox A5; homeo box A5; HOX1, HOX1C; homeobox protein Hox-A5; homeo box 1C; homeo box A5; homeobox protein HOXA5; homeobox protein Hox-1C; HOX1; HOX1C; HOX1.3; MGC9376;
Additional info: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Also binds to its own promoter. Binds specifically to the motif 5-CYYNATTA[TG]Y-3.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave