Qiagen
Home  >  Products  >  Anti-HLA-DQB2 (full length) polyclonal antibody

Anti-HLA-DQB2 (full length) polyclonal antibody

Cat no: DPABH-09456


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09456
Reactivities: Human
Hosts: Mouse
Applications: Western Blot
Size: 50 ug
Clone: N/A
Gene: 3120
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Recombinant full length protein corresponding to Human HLA-DQB2 aa 1-231.Sequence: MSWKMALQIPGGFWAAAVTVMLVMLSTPVAEARDFPKDFLVQFKGMCYFT NGTERVRGVARYIYNREEYGRFDSDVGEFQAVTELGRSIEDWNNYKDFLE QERAAVDKVCRHNYEAELRTTLQRQVEPTVTISPSRTEALNHHNLLVCSV TDFYPAQIKVQWFRNDQEE
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3120
Alternative names: HLA-DQB2; major histocompatibility complex, class II, DQ beta 2; HLA DXB; HLA class II histocompatibility antigen, DQ beta 2 chain; MHC class II antigen DQB2; major histocompatibility complex, class II, DQ beta 1; HLA class II histocompatibility antigen, DX beta chain; DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB)); HLA-DXB; HLA-DQB1;
Additional info: Belongs to the MHC class II family. Contains one Ig like C1 type (immunoglobulin like) domain.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave