Qiagen
Home  >  Products  >  Anti-HLA-DOA (full length) polyclonal antibody

Anti-HLA-DOA (full length) polyclonal antibody

Cat no: DPABH-09438


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09438
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 3111
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human HLA-DOA aa 1-250. (NP_002110.1).Sequence: MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTH EFDEEQLFSVDLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILV ERSNRSRAINVPPRVTVLPKSRVELGQPNILICIVDNIFPPVINITWLRN GQTVTEGVAQTSFYSQP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 3111
Alternative names: HLA-DOA; major histocompatibility complex, class II, DO alpha; HLA DNA, HLA DZA; HLA class II histocompatibility antigen, DO alpha chain; HLA D0 alpha; HLA-D0-alpha; MHC DN-alpha; MHC DZ alpha; lymphocyte antigen; MHC class II antigen DOA; major histocompatibility complex, class II, DN alpha; HLADZ; HLA-DNA; HLA-DZA;
Additional info: HLA-DOA belongs to the HLA class II alpha chain paralogues. HLA-DOA forms a heterodimer with HLA-DOB. The heterodimer, HLA-DO, is found in lysosomes in B cells and regulates HLA-DM-mediated peptide loading on MHC class II molecules. In comparison with classical HLA class II molecules, this gene exhibits very little sequence variation, especially at the protein level.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave