Qiagen
Home  >  Products  >  Anti-GOLGA7 (full length) polyclonal antibody

Anti-GOLGA7 (full length) polyclonal antibody

Cat no: DPABH-09890


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09890
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 51125
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human GOLGA7 aa 1-134.Sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL NNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQ NEKIYAPQGLLLTDPIERGLRVFRLKLPFMKTEA Run BLAST with Run BLAST with
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 51125
Alternative names: GOLGA7; golgin A7; golgi autoantigen, golgin subfamily a, 7; Golgin subfamily A member 7; GCP16; GOLGA3AP1; GOLGA7A; HSPC041; Golgi complex-associated protein of 16kDa; golgi complex-associated protein of 16 kDa; MGC4876; MGC21096;
Additional info: GOLGA7 (Golgi autoantigen, golgin subfamily a, 7) is a member of the golgin family and may be involved in protein transport from the Golgi to the cell surface. GOLGA7 forms a protein complex with ZDHHC9. This ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for H-RAS and N-RAS.

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave