Qiagen
Home  >  Products  >  Anti-GAL3ST1 (full length) polyclonal antibody

Anti-GAL3ST1 (full length) polyclonal antibody

Cat no: DPABH-09785


Supplier: Creative Diagnostics
Star_fadedStar_fadedStar_fadedStar_fadedStar_faded
0 reviews | Write a Review Pencil
Creative Diagnostics offers thousands of monoclonal/polyclonal antibodies and conjugates validated for use in a variety of common applications including WB, FC, IHC, ICC, IF, IP, and more.
Catalogue number: DPABH-09785
Reactivities: Human
Hosts: Rabbit
Applications: Western Blot
Size: 100 ug
Clone: N/A
Gene: 9514
Form: Liquid
Storage buffer: pH: 7.20; Constituent: 100% PBS
Antigen: Full length protein corresponding to Human GAL3ST1 aa 1-423.Sequence: MLPPQKKPWESMAKGLVLGALFTSFLLLMYSYAVPPLHAGLASTTPEAAA SCSPPALEPEAVIRANGSAGECQPRRNIVFLKTHKTASSTLLNILFRFGQ KHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICNHMRFHYDEVR GLVPTNAIFITVLRDPARLFESSFHYFGPVVP
Species: Human
Isotype: IgG
Clonality: Polyclonal
Storage temp: Shipped at 4 degrees C. Store at 4 degrees C short term (1-2 weeks). Upon delivery aliquot. Store at -20 degrees C long term. Avoid freeze / thaw cycle.
Entrez gene: 9514
Alternative names: GAL3ST1; galactose-3-O-sulfotransferase 1; galactosylceramide sulfotransferase; cerebroside (3 phosphoadenylylsulfate:galactosylceramide 3) sulfotransferase; CST; GalCer sulfotransferase; cerebroside sulfotransferase; 3-phosphoadenosine-5-phosphosulfate:GalCer sulfotransferase; 3-phosphoadenylylsulfate:galactosylceramide 3-sulfotransferase; cerebroside (3-phosphoadenylylsulfate:galactosylceramide 3) sulfotransferase;
Additional info: Catalyzes the sulfation of membrane glycolipids. Seems to prefer beta-glycosides at the non-reducing termini of sugar chains attached to a lipid moiety. Catalyzes the synthesis of galactosylceramide sulfate (sulfatide), a major lipid component of the myelin sheath and of monogalactosylalkylacylglycerol sulfate (seminolipid), present in spermatocytes (By similarity). Also acts on lactosylceramide, galactosyl 1-alkyl-2-sn-glycerol and galactosyl diacylglycerol (in vitro).

Get Quote

  • Best Price Guaranteed
  • Quick Response Time
  • Exclusive Promotions
Enquiry_down_arrow
Creative Diagnostics
Get a Quote Direct from
Creative Diagnostics

By submitting this form you agree to your details being passed to Creative Diagnostics for the purpose of generating the best quote*

Button_on Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave Button_off_biosave